marimolina19
marimolina19
27-10-2022
Mathematics
contestada
Cómo es 5/3 en decimal
Respuesta :
VER TODAS LAS RESPUESTAS ( 51+ )
Otras preguntas
state 2 differences between cellular respiration and photosynthesis
As magma rises, pressure , causing dissolved gases to expand and form bubbles. The size of the bubbles increases, exerting a lot of force. The force of the expa
6+4/-6-4 as a fraction
What is the cause of Laertes's anger toward the king?
Forces F1 , F2 , and F3 act on the structure of the figure, shown in an overhead view. We wish to put the structure in equilibrium by applying a fourth force, a
An increase in the price level results in a(n) ________ in the quantity of real GDP demanded because ________. A) decrease; a higher price level reduces consump
A woman on a bridge 75.0 m high sees a raft floating at a constant speed on the river below. Trying to hit the raft, she drops a stone from rest when the raft h
which fraction is bigger 3/8 or 1/3
There is a right and wrong way to think about health. True False
A membrane protein has the following amino acid sequence: EWDRHDFESGPTFIWLIWLVLAVLFLLLWAVLRPGKYKDKHE Considering the R groups on the amino acids, predict the re
